PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB_related
Protein Properties Length: 346aa    MW: 37693.3 Da    PI: 7.4157
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019115.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-12112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+  ++ + ++lG+g+W+ Iar   ++Rt+ q+ s+ qky
      Pbr019115.1 112 PWTEDEHRMFLIGLQKLGKGDWRGIARSYVTTRTPTQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.209105161IPR017930Myb domain
SuperFamilySSF466899.36E-17107162IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-18108160IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-10109155IPR009057Homeodomain-like
SMARTSM007172.8E-9109159IPR001005SANT/Myb domain
PfamPF002493.3E-10112156IPR001005SANT/Myb domain
CDDcd001671.76E-8112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RVGSSSSSPS LGGGVKLFGV RLTDGSIIKK SASMGNLSSA  60
AAHYHSSSPN PDSPSSDPLH DPVHVPDGYL SDDPAHASSS VNRRGDRKKG TPWTEDEHRM  120
FLIGLQKLGK GDWRGIARSY VTTRTPTQVA SHAQKYFIRQ SNATRRKRRS SLFDMVPDMA  180
PPLPEEQIFL PSSWEGDSED ANSLPSLNLS LSSESKPMET THEETVIEHD HEPAMGSNGF  240
PPMPPPYVPA YMSYPWPYWA PSAGPFREMV GEPSRQPVLR PIPIVPKEPV NVDALGMSQL  300
SLGEAERGVK EPSPLSLKLL GEPSRQSALN EALEWGYIGV AMTMK*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744750.0DQ074475.1 Malus x domestica MYBR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342531.10.0PREDICTED: uncharacterized protein LOC103934507
RefseqXP_009353549.10.0PREDICTED: uncharacterized protein LOC103944815
TrEMBLQ2LMD70.0Q2LMD7_MALDO; MYBR2
STRINGGLYMA13G43120.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-76MYB_related family protein